- TMCO6 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83463
- 0.1 ml
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: GALSTLGLLL LDLAGAVQKT EDAGLELLAC PVLRCLSNLL TEAAVETVGG QMQLRDERVV AALFILLQFF FQKQPSLLPE GLWLLNNLTA
- TMCO6
- transmembrane and coiled-coil domains 6
- PRO1580
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GALSTLGLLLLDLAGAVQKTEDAGLELLACPVLRCLSNLLTEAAVETVGGQMQLRDERVVAALFILLQFFFQKQPSLLPEGLWLLNNLTA
Specifications/Features
Available conjugates: Unconjugated